PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna08006.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 719aa    MW: 80538 Da    PI: 8.8622
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna08006.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.8e-18149195148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g WT eEd +l+++vkq+G++ W+ Ia+++  gR +kqc++rw+++l
  mrna08006.1-v1.0-hybrid 149 KGQWTDEEDRKLIRLVKQYGMRKWAQIAEKLV-GRAGKQCRERWHNHL 195
                              799*****************************.*************97 PP

2Myb_DNA-binding57.62.8e-18201243145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              +++WT+eE+++lv+a+++ G++ W+ Ia++++ gRt++ +k++w+
  mrna08006.1-v1.0-hybrid 201 KDSWTEEEEKILVEAHAEVGNR-WAEIAKRIP-GRTENAIKNHWN 243
                              679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.322144199IPR017930Myb domain
SuperFamilySSF466892.8E-30146242IPR009057Homeodomain-like
SMARTSM007173.1E-17148197IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-27150202IPR009057Homeodomain-like
PfamPF139218.5E-20152210No hitNo description
CDDcd001671.62E-15152195No hitNo description
SMARTSM007179.0E-18200248IPR001005SANT/Myb domain
PROSITE profilePS5129421.39200250IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-21203248IPR009057Homeodomain-like
CDDcd001671.82E-13203246No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 719 aa     Download sequence    Send to blast
MEGEDSAASD HHLHHRHHGV YGFRNNSIQT PHHHHHQLFR PGPPLTAIDR FLWSQNNAKN  60
KERLISSSNG CSSFGGAMAD LQPCSNWPPS SLGEASLDEM LFINHGDAMT WPPEKIQNPN  120
MVFKEDQMKV GSKGVGKRAK KGSSVPLIKG QWTDEEDRKL IRLVKQYGMR KWAQIAEKLV  180
GRAGKQCRER WHNHLRPDIK KDSWTEEEEK ILVEAHAEVG NRWAEIAKRI PGRTENAIKN  240
HWNATKRRQN SRRKNKQTDT KVGSSSSSSN KPPQPSILQN YIKSKNFNNK PNNNSSSNVT  300
PTQSNISTTT PTSSSTLTQD EPSKIPFNIV LSDPSDLSSC DHSPLNIAAD SYNDDELLFM  360
QNFFNNNNNV QNHNQQQQPL PIDNYNNGLT ATPMDTTGWF ATSIPKPNMC TNNNIQAAVH  420
NIESHIGSST ENASSINPVI SADHYLSYLL NGGASSSSSS ANHDHHMGNC YNMNIDLVTH  480
QQQAAASATE RREMDLIEMV SSSSSSQFAQ GWSFSFSVSA YAGKYQCGSV LVAQMQTLAL  540
GFCSSRSLAS EEVLPSHDAY LTLSSRACTL SVQEGLYRSI FWSGCRSVLL GGVRMEPNVV  600
QELLLEEIGF RFNQRMGSRN ASCRQIADDD KLLDWRSDGR AFNLKREIRQ GGVDFVVGYG  660
MASLRWRRQR RPLSRQRWRS TMGVLRVPKM DSQTWAWAIV GLAGEHWVLD LRPAHCWV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-441472495107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00567DAPTransfer from AT5G58850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011460934.10.0PREDICTED: myb-like protein Q
TrEMBLM5WL971e-143M5WL97_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41293158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.12e-58myb domain protein 119